Roseiflexus sp. RS-1: RoseRS_0862
Help
Entry
RoseRS_0862 CDS
T00542
Name
(GenBank) glycyl-tRNA synthetase
KO
K01880
glycyl-tRNA synthetase [EC:
6.1.1.14
]
Organism
rrs
Roseiflexus sp. RS-1
Pathway
rrs00970
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:
rrs00001
]
09120 Genetic Information Processing
09122 Translation
00970 Aminoacyl-tRNA biosynthesis
RoseRS_0862
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
rrs01007
]
RoseRS_0862
09182 Protein families: genetic information processing
03016 Transfer RNA biogenesis [BR:
rrs03016
]
RoseRS_0862
03029 Mitochondrial biogenesis [BR:
rrs03029
]
RoseRS_0862
Enzymes [BR:
rrs01000
]
6. Ligases
6.1 Forming carbon-oxygen bonds
6.1.1 Ligases forming aminoacyl-tRNA and related compounds
6.1.1.14 glycine---tRNA ligase
RoseRS_0862
Amino acid related enzymes [BR:
rrs01007
]
Aminoacyl-tRNA synthetase
Class II (C/G)
RoseRS_0862
Transfer RNA biogenesis [BR:
rrs03016
]
Eukaryotic type
Aminoacyl-tRNA synthetases (AARSs)
Other AARSs
RoseRS_0862
Mitochondrial biogenesis [BR:
rrs03029
]
Mitochondrial DNA transcription, translation, and replication factors
Mitochondrial transcription and translation factors
Other mitochondrial DNA transcription and translation factors
RoseRS_0862
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
HGTP_anticodon
tRNA-synt_2b
DUF7129
HypA
TackOD1
Zn_Ribbon_TF
Zn_ribbon_PF0610
Motif
Other DBs
NCBI-ProteinID:
ABQ89275
LinkDB
All DBs
Position
complement(1075779..1077371)
Genome browser
AA seq
530 aa
AA seq
DB search
MPATTLDQLVSLCKRRGFVFPSSEIYGGLQGVFDWGPLGVELKNNIISSWWRTNVYERDD
MEGLDAAILMNRLTWRYSGHEETFNDPLVDCRDCKSRWRADHIRGRCPNCGSTNLTEPRP
FNMMFKTAVGPVADADSFAYLRPETAQGIFVNFGNVLATSSRKLPFGIAQVGKAFRNEIN
PRNFLFRVREFEQMEIEYFVMPGTEDEWHQRWLEDRLAWWESIGIPRARIKIYDVPPDEL
AHYSKRTFDLMYDYPTLGYEEVEGIASRTDYDLGSHSRDQETLNLTARANPNRDSTARLT
YYDPESRRHIVPFVIEPSAGVGRCFLAVLAEAYDEQMVKAPPPERVHAVTDALEAFLKSV
GRNEKLASEIRDALVERGQAILAGLPETMPQIETLLAMPGADQIDIGKKLRGQAQGPIDE
YFRTVLHLKPHLAPIRVAVFPLKRNHEGLVAMARELRTAIQSGSSFRTVYDDTGAIGKLY
RRQDEIGTPYCVTVDFQSLEDGTVTVRDRDTMQQVRIPASEVRAYVTGRG
NT seq
1593 nt
NT seq
+upstream
nt +downstream
nt
atgccggcaaccaccttggatcagttggtctcgctttgcaaacgacgtggctttgtgttt
cccagctccgaaatctacggcggactgcaaggcgtcttcgactggggaccactgggggtt
gagttgaaaaacaatatcatctcctcctggtggcgcaccaatgtctatgagcgcgacgat
atggaagggctggacgccgccattttgatgaaccgtctgacctggcgctattccggtcac
gaggaaacgttcaacgatccgctggtcgattgccgggactgcaagagccgctggcgcgcc
gatcacatcagggggcgttgcccgaactgcggttcaaccaacctgaccgaaccgcgaccg
ttcaatatgatgttcaagaccgccgtcggtcctgtggcagacgccgactcatttgcgtat
ctgcgcccggaaacagcgcagggcatcttcgtcaacttcgggaatgtgctggcgaccagc
agtcgtaaactgccgtttggcatcgcacaggttggcaaagcgttccgcaatgagatcaac
ccgcgcaactttctcttccgtgtgcgcgagttcgagcagatggagatcgaatacttcgta
atgcccggaaccgaggacgaatggcaccagcgctggctggaagatcggctcgcctggtgg
gagagcatcggcatcccgcgcgcgcgcatcaagatttacgacgtgccgcccgacgaactg
gcgcactattccaaacgcaccttcgacctgatgtacgactacccgaccctggggtatgag
gaagtcgaagggatcgccagtcgcaccgactatgacctcggttcacacagccgcgaccag
gagacgctcaacctgacggcgcgcgccaatcccaaccgcgatagcaccgccaggctgacc
tactacgatccggagagcaggcggcatatcgtgcccttcgtgatcgaaccgtcggctggt
gtggggcgttgtttcctggcagtgcttgcagaagcctacgatgagcagatggtcaaagcg
cctcctcctgaacgagtgcacgccgttaccgacgcactcgaagcattcctcaagtcggtc
ggcagaaacgaaaaactggcgtccgaaatacgcgacgcacttgttgaacgcggacaggca
atcctcgcgggactgccagagaccatgccgcagatcgagacgttgctggcaatgccgggc
gcggatcagatcgacatcggaaagaaattgcgtggtcaggcacagggaccgatcgatgaa
tacttccgtactgtgttgcatctgaaaccgcatctcgcaccgatccgcgtcgctgtcttt
ccactcaagcgcaaccacgaaggtctggttgccatggcgcgcgaactgcgcacggcgatc
cagagcggcagttcctttcgcaccgtctacgatgataccggcgctatcggcaaactctac
cgtcgccaggacgagatcggtacaccgtactgtgtgacggtcgatttccagtcgctcgaa
gatggcaccgtcaccgtgcgcgaccgcgataccatgcaacaggtgcgcatacctgcatcc
gaggtgcgggcgtatgtgacgggaagaggttga
DBGET
integrated database retrieval system