KEGG   Roseiflexus sp. RS-1: RoseRS_1594
Entry
RoseRS_1594       CDS       T00542                                 
Name
(GenBank) phosphonate ABC transporter, ATPase subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
rrs  Roseiflexus sp. RS-1
Pathway
rrs02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rrs00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RoseRS_1594
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rrs02000]
    RoseRS_1594
Enzymes [BR:rrs01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     RoseRS_1594
Transporters [BR:rrs02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    RoseRS_1594
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_16 AAA_22 AAA_23 RsgA_GTPase nSTAND1 AAA_27 AAA_30 AAA_18 NB-ARC NACHT AAA_28 AAA_25 MMR_HSR1 AAA_24 nSTAND3 NTPase_1 DO-GTPase2
Other DBs
NCBI-ProteinID: ABQ89986
LinkDB
Position
complement(1946026..1946811)
AA seq 261 aa
MALLEIDTLTKRYGGETLALDSVSFSVHDGEFVAIIGPSGAGKSTLLRCINRLIDISGGD
IRFDGMSVPQLRGVALRRHRTRIGMIFQHYNLVNRLSVIENVLHGRLGYKNTLQGILGLY
SEAEKREAVRILENLGLSEQMYKRCDQLSGGQKQRVGIARALVQQPKMLLCDEPIASLDP
GSAKVIMDTLRDINATMGITVLVNLHQVDVALRYARRIIGINRGQVVYDGSPDTLTNAQI
YQIYGSEAGELILDLKERYAA
NT seq 786 nt   +upstreamnt  +downstreamnt
atggctctgctcgaaatcgatacgctcaccaagcgctacggtggagagacgctcgcgctt
gattcggtcagtttctctgtgcatgacggagaatttgtggcgattatcggtccttccggc
gccgggaagtcgaccttgctgcgctgcatcaaccgattgatcgatatcagcggcggcgat
attcgctttgatggcatgagcgtaccacagttgcgcggcgttgccctgcgtcgtcaccgc
acccggatcggcatgatctttcaacactacaacctggtcaatcgcctgagcgtgattgaa
aatgtgctgcacggtcggcttggctacaaaaacacgctgcaaggcattcttggtttgtac
agcgaagcggagaagcgcgaagcggtacgcatcctcgagaacctggggctgagtgagcag
atgtacaaacgttgcgatcagctcagcggcggtcagaagcagcgcgttggcattgctcgt
gcgctggtgcaacagccgaagatgctcctgtgcgacgagccgattgcttcactcgatccg
ggttcggcgaaggtgattatggatacgcttcgtgacatcaacgctaccatgggcatcacg
gtgctggtcaatctccaccaggtcgatgtcgcgctccgctatgcccggcggattatcggc
atcaatcggggacaggtggtctacgatggatcgccggatacattgaccaatgcgcagata
taccagatctacggctcagaagccggtgaactgattctcgatttgaaggaacgctatgcc
gcctga

DBGET integrated database retrieval system