Roseiflexus sp. RS-1: RoseRS_2245
Help
Entry
RoseRS_2245 CDS
T00542
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
rrs
Roseiflexus sp. RS-1
Brite
KEGG Orthology (KO) [BR:
rrs00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
RoseRS_2245
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
UreE_N
Motif
Other DBs
NCBI-ProteinID:
ABQ90624
LinkDB
All DBs
Position
2766611..2766952
Genome browser
AA seq
113 aa
AA seq
DB search
MATHMPAEVSVPLTTTIPTTEYVVVTEDELERPYRVIIENDDVTPMDFVVLILLTIFELG
FEQSVAIMLEAHHNGRAHVVTLPYEEAQRRVYEAHHAAREAGYPLSFYLEPDV
NT seq
342 nt
NT seq
+upstream
nt +downstream
nt
gtggcaacgcacatgcctgcagaagtttcggttccgctcacaaccaccattccgacgacg
gaatatgtcgtcgtcaccgaagacgaactggaacgtccataccgcgtcatcatcgaaaat
gacgatgtgacgccgatggactttgtggtgctgatattgctgaccatcttcgaactgggc
ttcgagcaatcagttgccattatgctcgaagcgcaccacaacggacgagcgcacgttgtg
acgctgccctatgaagaagcgcagcgtcgcgtctacgaggcgcaccacgcagcgcgcgaa
gctggctatccgctgagtttctacctggagccggatgtgtga
DBGET
integrated database retrieval system