Rhodospirillum rubrum ATCC 11170: Rru_A1261
Help
Entry
Rru_A1261 CDS
T00310
Name
(GenBank) Binding-protein-dependent transport systems inner membrane component
KO
K02025
multiple sugar transport system permease protein
Organism
rru
Rhodospirillum rubrum ATCC 11170
Brite
KEGG Orthology (KO) [BR:
rru00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
rru02000
]
Rru_A1261
Transporters [BR:
rru02000
]
ABC transporters, prokaryotic type
Saccharide, polyol, and lipid transporters
Putative multiple sugar transporter
Rru_A1261
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
Motif
Other DBs
NCBI-ProteinID:
ABC22062
UniProt:
Q2RUY3
LinkDB
All DBs
Position
complement(1482167..1483063)
Genome browser
AA seq
298 aa
AA seq
DB search
MSGAADRPMTALERADRRFGWFLTLPGVLMLAATIAFPLLWAVATSLFDFTLIAPTYDTF
VGLDNYALALGNTEFLHASWLTVGFVVAVVLIEFAIGFLIALMLNGVRRGKPIYYAILLC
PLLINPVVVGLVWRMVLHPTLGVANYALGLIGLSPVNWLGDVTVAFWTLVGVDIWHQVSF
MIVLLLAGLSALPAEPYEAARVDGASVFQRFWHITLPLMRRVILVTLLIRMIFAVKTYDL
VYIMTRGGPGTATDLVSYSIYRTAFVGLNLGQATAMAGLLLIPVLGITAYLYRLMRKA
NT seq
897 nt
NT seq
+upstream
nt +downstream
nt
gtgagcggggcggcggatcgtccgatgacggctctcgaacgggcggaccgccgtttcggc
tggttcctcacccttcccggcgtgcttatgctggcggccaccatcgcctttccgctgctg
tgggcggtggcgaccagcctgtttgatttcacgctgatcgcccccacctacgacaccttc
gtcggccttgataattacgccttggccctgggcaacacggaattcctccacgcctcgtgg
ctgaccgtcggcttcgttgtcgccgtcgttctcatcgaattcgccatcggctttctcatc
gccctgatgctcaacggcgtgcggcggggcaagccgatctattacgccatcttgttatgc
cccttgctgatcaatccggtggtggtcggtctggtctggcgcatggttctccaccccacg
ctgggggtggccaattacgccctcggcctgatcggcctttccccggtcaattggctgggc
gatgtgaccgtcgccttctggaccctggtcggcgtcgatatctggcatcaggtctcgttc
atgatcgtcctgctgctcgccggcctctcggccctgccggccgaaccctatgaggcggcc
cgcgtcgatggcgccagcgtcttccagcgcttctggcacatcaccttgccgctgatgcgc
cgggtgatcctggtcaccttgctgatccgcatgatcttcgccgtcaaaacctatgacctc
gtctacatcatgacccggggcggcccgggcacggccaccgatctggtcagctattcgatc
taccgcaccgccttcgtcggcctcaaccttggtcaggcgacggcaatggccggcttgctg
ctgatcccggttctggggatcaccgcctatctctaccggctgatgcgcaaggcctga
DBGET
integrated database retrieval system