Rathayibacter rathayi: C1O28_07105 Help Entry C1O28_07105       CDS       T05845                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rry  Rathayibacter rathayi Pathway rry01100   Metabolic pathways rry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C1O28_07105    00074 Mycolic acid biosynthesis     C1O28_07105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C1O28_07105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AZZ48989 UniProt:  A0ABD6WAI9 LinkDB All DBs Position 1466716..1466964 Genome browser AA seq 82 aa AA seqDB search MALSTAEVLAGLAELVNDETGIATDAVEMDKSFTDDLDIDSISMMTIVVNAEEKFDVKIP DDEVKNLKTVGDAVTFIVKASE NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcactgtccaccgcagaagtcctcgccggcctcgccgagcttgtcaacgacgagacg ggcatcgcgaccgacgccgtcgaaatggacaagtcgttcaccgacgacctcgacatcgac tccatctcgatgatgaccatcgtcgtcaacgccgaggagaagttcgacgtgaagatcccc gacgacgaggtgaagaacctcaagaccgtcggcgacgcggtcaccttcatcgtcaaggcg tccgagtag

DBGET integrated database retrieval system