KEGG   Rhodoferax saidenbachensis: RS694_00560
Entry
RS694_00560       CDS       T04623                                 
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
rsb  Rhodoferax saidenbachensis
Pathway
rsb00430  Taurine and hypotaurine metabolism
rsb00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:rsb00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    RS694_00560
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    RS694_00560
Enzymes [BR:rsb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     RS694_00560
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: APW41182
UniProt: A0A1P8K5B1
LinkDB
Position
complement(104042..104875)
AA seq 277 aa
MTLDIRPLGPAIGALVSNIDLTEPLRNTDRDTLQTALLQHHVLFFENQPVTPVQQRDLAR
AFGELHIHPVYPQHPEASEIIVLDTHNDNPPDNDNWHTDVTFIKTPPLGAILSARVLPPH
GGDTLWASGIAAYEALSEPLRRFLDPLRAEHSFVQSFPAWRYARTPEERKTWEAAVAKSP
EVTHPVVRTHPVSGKHGLFVNEGFTSRIVDLAKAESDALLAFLRVHLAKPEFTVRWRWKQ
YDLAFWDNRLTQHYATADYLPHRRVMHRATILGDAPF
NT seq 834 nt   +upstreamnt  +downstreamnt
atgacactcgacatccgccccctgggccctgccatcggcgccctggtcagcaacattgac
ctgaccgaacccctacgcaacaccgaccgcgacaccttgcagacagccctgctgcagcac
cacgtgttgttctttgaaaaccagcccgtcacgccggtgcaacagcgcgacttggcgcgc
gcctttggcgagctgcacatccacccggtgtacccgcagcacccggaggcgagcgaaatc
atcgtgctggacacgcacaacgacaacccgcccgacaacgacaactggcacaccgatgtg
accttcatcaagacgccgccgctgggcgccatcctgtcggcgcgcgtgttgccgccgcac
gggggcgacaccctgtgggccagcggcattgcagcgtatgaagcgctgtctgaacccctg
cgccggtttctagacccgctgcgggccgagcacagctttgtgcagtccttcccggcctgg
cggtatgcgcgcacgcccgaagaacgcaagacctgggaagccgcggtggctaagtcgccc
gaggtaacgcaccccgtggtgcgtacccacccggtcagcggcaaacacggcctgtttgtg
aacgagggctttaccagccgtatcgtagacctggccaaggcagagagtgatgcgctgctg
gcctttctgcgcgtgcacctggccaagcctgaattcaccgtgcgctggcgctggaagcag
tacgacctagccttttgggacaaccgcctgacccagcactacgccaccgccgactacctg
ccgcaccgccgcgtgatgcaccgcgccaccatcctcggggacgcacccttctga

DBGET integrated database retrieval system