Rhodoferax saidenbachensis: RS694_14605 Help Entry RS694_14605       CDS       T04623                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rsb  Rhodoferax saidenbachensis Pathway rsb01100   Metabolic pathways rsb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RS694_14605    00074 Mycolic acid biosynthesis     RS694_14605   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RS694_14605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  APW43643 UniProt:  A0A1P8KCA7 LinkDB All DBs Position complement(3068674..3068913) Genome browser AA seq 79 aa AA seqDB search MSDIEVRVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQAAIDYANTHKKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatattgaagtacgcgtcaaaaaaatcattgccgagcaactcggtgttgaagag tctcaagtcaccaacgaaaaagcctttgtggctgatctgggtgctgactctctggacaca gtggagctggtgatggcattggaagacgagttcggaattgaaattcctgacgaagacgcc gaaaaaatcaccacagtgcaagctgcgatcgattacgccaacacccacaaaaaggcctaa

DBGET integrated database retrieval system