Ralstonia pseudosolanacearum FQY_4: F504_457 Help Entry F504_457          CDS       T02751                                  Name (GenBank) Acyl carrier protein (ACP1)   KO K02078   acyl carrier protein Organism rse  Ralstonia pseudosolanacearum FQY_4 Pathway rse00998   Biosynthesis of various antibiotics rse01100   Metabolic pathways rse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F504_457    00074 Mycolic acid biosynthesis     F504_457   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F504_457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGH82979 LinkDB All DBs Position 469773..470033 Genome browser AA seq 86 aa AA seqDB search MNALEKELAELMIGELNLEDIQLENVSADTPLYGEGFALDSIDILEIALLVSKKYGFELR SGNPDNQKIFATLGSLAAYIAAHRVR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgcactggaaaaagagctcgccgagctgatgatcggcgaactgaatctcgaagac atccaactcgaaaacgtgtccgccgataccccgctatatggggaaggcttcgcgctcgac tccatcgatatcctggaaatcgcgctgctggtctcgaaaaaatacggcttcgaactgcgc tctgggaatccggataaccagaagatcttcgccacgctcggttcgctggccgcttacatc gcggcgcaccgcgtgcgctag

DBGET integrated database retrieval system