Ralstonia syzygii subsp. celebesensis: JK151_19340 Help Entry JK151_19340       CDS       T07219                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rsg  Ralstonia syzygii subsp. celebesensis Pathway rsg00998   Biosynthesis of various antibiotics rsg01100   Metabolic pathways rsg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JK151_19340 (acpP)    00074 Mycolic acid biosynthesis     JK151_19340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JK151_19340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QQV57614 LinkDB All DBs Position pRscUGMSS_Db01:complement(664373..664612) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtcaagaagatcgtcgccgagcagctgggcgtggccgag gctgacatcaagaacgaatcgtcgttcgtcaacgatcttggcgcggactcgctcgacacg gttgaactggtgatggcgttggaagatgagttcggtatggaaatcccggacgaagaagct gagaagatcaccacggtgcaacaagccatcgattacgctcgcgccaacgtcaaggcgtaa

DBGET integrated database retrieval system