Cereibacter sphaeroides ATCC 17029: Rsph17029_2911 Help Entry Rsph17029_2911    CDS       T00484                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism rsh  Cereibacter sphaeroides ATCC 17029 Brite KEGG Orthology (KO) [BR:rsh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rsh03036]     Rsph17029_2911    03400 DNA repair and recombination proteins [BR:rsh03400]     Rsph17029_2911 Chromosome and associated proteins [BR:rsh03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     Rsph17029_2911 DNA repair and recombination proteins [BR:rsh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       Rsph17029_2911 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ABN78013 LinkDB All DBs Position 1:3067075..3067353 Genome browser AA seq 92 aa AA seqDB search MKKTIERLNWDELLDLYGRISKALDACETRQAAAKARSMAAAISKGAGSGTKRVSYFNPA NRAVSWNGRGRCPNWFKVAMAQGRTPEELASL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagactattgagcggttgaactgggacgaactgctggacctctatggacggatc tccaaggcactcgacgcctgcgagacccggcaagccgccgcgaaggcgcgatccatggca gcagcgatctccaaaggggcaggaagcgggacgaagcgcgtgagctacttcaacccggca aatcgcgccgtgtcgtggaatggccgcggacggtgtccgaactggttcaaggtggccatg gctcaggggcgcacgcccgaggaactggcctcgctctga

DBGET integrated database retrieval system