KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_3654
Entry
Rsph17029_3654    CDS       T00484                                 

Name
(GenBank) cobalamin B12-binding domain protein
  KO
K20907  2-hydroxyisobutanoyl-CoA mutase small subunit [EC:5.4.99.64]
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rsph17029_3654
Enzymes [BR:rsh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.64  2-hydroxyisobutanoyl-CoA mutase
     Rsph17029_3654
SSDB
Motif
Pfam: B12-binding Aldolase LpxI_N IMPDH Mut7-C
Other DBs
NCBI-ProteinID: ABN78744
UniProt: A3PQX8
LinkDB
Position
2:755412..755819
AA seq 135 aa
MSTQIRVLLAKVGLDGHDRGVKVVARTLRDAGMDVVYSGLHRTPEEVVTAAVQEDVDILG
VSLLSGVQMTVFPKIFALLKEHKVEDMIVVAGGVMPDEDVIELKKMGVAEVLLQDTPPQH
IIDTLTGLVKARGDR
NT seq 408 nt   +upstreamnt  +downstreamnt
atgtcgacccagatccgtgtgctgctcgcgaaggttggcctcgatggccacgaccgcggt
gtgaaggtggtggcccgcaccctgcgcgatgccgggatggatgtcgtctattccggtctc
caccgcaccccggaggaggtggtgacggccgcggtgcaggaggatgtggacatcctcggc
gtcagcctcctgtcgggcgtgcagatgacggtctttccgaagatcttcgcgctgctgaag
gagcacaaggtcgaggacatgatcgtggtcgcggggggcgtcatgcccgacgaggatgtg
atcgagctgaagaagatgggcgtggccgaggtgctgctgcaggacacgccgccccagcac
atcatcgacaccctcacgggtctggtgaaggcgcggggagaccgctga

DBGET integrated database retrieval system