Cereibacter sphaeroides KD131: RSKD131_0778 Help Entry RSKD131_0778      CDS       T00844                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rsk  Cereibacter sphaeroides KD131 Pathway rsk01100   Metabolic pathways rsk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSKD131_0778    00074 Mycolic acid biosynthesis     RSKD131_0778   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSKD131_0778 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ACM00638 UniProt:  B9KQD1 LinkDB All DBs Position 1:784499..784732 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgctgatcgcgtgaagaagatcgtcgtcgagcatctgggcgtcgaagag gagaaggtgaccgagaatgcctcgttcatcgacgacctcggcgcggacagcctcgacacg gtcgagctcgtgatggccttcgaggaagagttcggcatcgagatcccggacgatgcggcc gaaaccatccagaccttcggcgatgcggtgaagttcatctcggaagccgcctga

DBGET integrated database retrieval system