Ralstonia solanacearum PSI07: RPSI07_2340 Help Entry RPSI07_2340       CDS       T01273                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism rsl  Ralstonia solanacearum PSI07 Pathway rsl00998   Biosynthesis of various antibiotics rsl01100   Metabolic pathways rsl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RPSI07_2340 (acpP)    00074 Mycolic acid biosynthesis     RPSI07_2340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RPSI07_2340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  CBJ51705 LinkDB All DBs Position complement(2458516..2458755) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtcaagaagatcgtcgccgagcagctgggcgtggccgag gctgacatcaagaacgaatcgtcgttcgtcaacgatcttggcgcggactcgctcgacacg gttgaactggtgatggcgttggaagatgagttcggtatggaaatcccggacgaagaagct gagaagatcaccacggtgcaacaagccatcgattacgctcgcgccaacgtcaaggcgtaa

DBGET integrated database retrieval system