Ralstonia solanacearum PSI07: RPSI07_mp1773 Help Entry RPSI07_mp1773     CDS       T01273                                  Symbol acpP Name (GenBank) Acyl carrier protein 3 (ACP3)   KO K02078   acyl carrier protein Organism rsl  Ralstonia solanacearum PSI07 Pathway rsl00998   Biosynthesis of various antibiotics rsl01100   Metabolic pathways rsl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RPSI07_mp1773 (acpP)    00074 Mycolic acid biosynthesis     RPSI07_mp1773 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RPSI07_mp1773 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  CBJ36091 LinkDB All DBs Position mpPSI07:2062595..2062858 Genome browser AA seq 87 aa AA seqDB search MNNPTVLDQIRHIIADALDKPVETIRAEQSFRRDLGADSLDSVEIVMAIEDQFAVEFDEN SAAAVDTVQDLVTYIEAARASRSAQRA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaacaacccgaccgtccttgaccagatccggcacatcattgcagacgcactcgacaag cccgtcgagaccatccgcgccgagcagtccttccgccgcgacctgggcgcggattcgctc gacagcgtggagatcgtgatggccatcgaagatcagttcgcggtcgagttcgatgagaac agcgccgccgccgtcgatacggtgcaggacctggtcacctacatcgaagccgcgcgggcc agccgcagcgcgcagcgcgcatga

DBGET integrated database retrieval system