Ralstonia solanacearum CMR15: CMR15_20170 Help Entry CMR15_20170       CDS       T02725                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism rsm  Ralstonia solanacearum CMR15 Pathway rsm00998   Biosynthesis of various antibiotics rsm01100   Metabolic pathways rsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMR15_20170 (acpP)    00074 Mycolic acid biosynthesis     CMR15_20170 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMR15_20170 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  CBJ38215 LinkDB All DBs Position 2127827..2128066 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtcaagaagatcgtcgcagagcaactgggcgtggccgaa gctgacatcaagaacgaatcgtcgttcgtcaacgatctcggcgcagactcgctcgacacg gttgagctggtgatggcgttggaagatgagttcggtatggaaatcccggacgaagaagct gagaagatcaccacggtgcaacaagccatcgattacgctcgcgccaacgtcaaggcgtaa

DBGET integrated database retrieval system