Ralstonia solanacearum CMR15: CMR15_mp10346 Help Entry CMR15_mp10346     CDS       T02725                                  Name (GenBank) putative acyl-carrier protein   KO K02078   acyl carrier protein Organism rsm  Ralstonia solanacearum CMR15 Pathway rsm00998   Biosynthesis of various antibiotics rsm01100   Metabolic pathways rsm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CMR15_mp10346    00074 Mycolic acid biosynthesis     CMR15_mp10346   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CMR15_mp10346 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CBJ39997 LinkDB All DBs Position CMR15_mp:complement(407420..407677) Genome browser AA seq 85 aa AA seqDB search MDSLKLEIKRLLIETLDLEDMTPADIDDDAPLFDTNGIGLDSIDALEIGIALRKQYQLTI AADDQRTREYFRSVNTLAELVQSHQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattctttaaagctcgaaattaagcggctcctgatcgagacgctcgatctggaggat atgacgccggcggatatcgacgacgacgcgccgctttttgacaccaacggcatcggcctg gattccatcgacgccttggaaatcggtatcgcgctgcgcaagcagtatcagctgaccatc gccgccgatgaccagcgcacgcgcgaatatttccgctcggtcaatacattggccgagctg gtccagagccaccaataa

DBGET integrated database retrieval system