Ralstonia solanacearum Po82: RSPO_m00039 Help Entry RSPO_m00039       CDS       T02005                                  Symbol hns Name (GenBank) hns-like protein   KO K03746   DNA-binding protein H-NS Organism rsn  Ralstonia solanacearum Po82 Brite KEGG Orthology (KO) [BR:rsn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rsn03036]     RSPO_m00039 (hns)    03400 DNA repair and recombination proteins [BR:rsn03400]     RSPO_m00039 (hns) Chromosome and associated proteins [BR:rsn03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RSPO_m00039 (hns) DNA repair and recombination proteins [BR:rsn03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RSPO_m00039 (hns) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AEG70681 UniProt:  F6G804 LinkDB All DBs Position megaplasmid:complement(42792..43079) Genome browser AA seq 95 aa AA seqDB search MASYKELLAQKAKLDEQLETARQKELAEVTERVRQVVLEYGLTAEDIGLAPKRGKRGPKS TVAPKYRDPKTGATWSGRGRAPAWIGKNRDRFLIA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcatcctacaaagaactgcttgcccagaaggcaaagctcgacgagcaactggaaacc gctcgccaaaaagaactggccgaagtcaccgagcgcgtgcggcaagtcgtgctggaatac ggcctgaccgccgaggacatcggcctggcaccgaagcgcggcaagcgcggccccaaatcc acggtggcgcccaagtaccgcgatccgaagaccggcgccacgtggtccggccgtggccgc gcaccggcctggatcggcaagaatcgtgaccgattcctgatcgcctga

DBGET integrated database retrieval system