Ralstonia pseudosolanacearum GMI1000: RSp0370 Help Entry RSp0370           CDS       T00071                                  Name (GenBank) putative acyl-carrier protein   KO K02078   acyl carrier protein Organism rso  Ralstonia pseudosolanacearum GMI1000 Pathway rso00998   Biosynthesis of various antibiotics rso01100   Metabolic pathways rso01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rso00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSp0370    00074 Mycolic acid biosynthesis     RSp0370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSp0370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAD17521 UniProt:  Q8XSU7 LinkDB All DBs Position megaplasmid:complement(476595..476852) Genome browser AA seq 85 aa AA seqDB search MDSLKLEIKRLLIETLDLEDMTPADIDDDAPLFDTNGIGLDSIDSLEIGIALRKQYQLTI AADDQRTREYFRSVSTLAALVQSHQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggattctttaaagctcgaaattaagcggctcctgatcgagacgctcgatctggaggat atgacgccggcggatatcgacgacgacgcgcctctttttgacaccaacggcatcggcctg gattccatcgactcattggaaatcggtatcgcactgcgcaagcagtatcagctgaccatc gccgccgatgaccagcgcacgcgcgaatatttccgctcggtcagtacattggccgcgctg gtccagagccaccaataa

DBGET integrated database retrieval system