Cereibacter sphaeroides 2.4.1: RSP_1194 Help Entry RSP_1194          CDS       T00284                                  Symbol grxC Name (GenBank) Glutaredoxin   KO K03676   glutaredoxin 3 Organism rsp  Cereibacter sphaeroides 2.4.1 Brite KEGG Orthology (KO) [BR:rsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rsp03110]     RSP_1194 (grxC) Chaperones and folding catalysts [BR:rsp03110]  Protein folding catalysts   Protein disulfide isomerase    RSP_1194 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Thioredoxin_3 CBD_PlyG Motif Other DBs NCBI-ProteinID:  ABA80376 UniProt:  Q3IYK8 LinkDB All DBs Position 1:complement(2965963..2966220) Genome browser AA seq 85 aa AA seqDB search MKSVEIYTTPTCGYCQAAKSLLRRKGVSYAETDVSTDPSLRAAMTQRAHGRRTVPQIFIG GQHVGGCDDLYALEDAGKLDPMLAD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaagtccgtcgagatctacacgacgcccacctgcggctattgtcaggcggccaagtcg ctgctgcgccgcaagggcgtgagctatgccgagaccgacgtcagcaccgatccctcgctg cgcgccgccatgacccagcgggcgcatggccggcggaccgtgccgcagatcttcatcggc ggccagcatgtcggcggatgcgacgatctctatgcgctcgaggatgcgggcaagctcgac ccgatgctggcagactga

DBGET integrated database retrieval system