Cereibacter sphaeroides 2.4.1: RSP_1388 Help Entry RSP_1388          CDS       T00284                                  Name (GenBank) DNA-binding protein HU, form N   KO K03530   DNA-binding protein HU-beta Organism rsp  Cereibacter sphaeroides 2.4.1 Brite KEGG Orthology (KO) [BR:rsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rsp03032]     RSP_1388    03036 Chromosome and associated proteins [BR:rsp03036]     RSP_1388    03400 DNA repair and recombination proteins [BR:rsp03400]     RSP_1388 DNA replication proteins [BR:rsp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RSP_1388 Chromosome and associated proteins [BR:rsp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RSP_1388 DNA repair and recombination proteins [BR:rsp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RSP_1388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  ABA80567 UniProt:  Q3IY17 LinkDB All DBs Position 1:3166362..3166649 Genome browser AA seq 95 aa AA seqDB search MSKPMTKTQLVATLADEMGSDKKTANAALDAIASIVAREVAAGGAVTLPGLGKVVCRERP ERQVRNPATGEQVTKAADKQVKFTIAKALKDSVNA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaaccgatgaccaagacgcagctcgtcgcgacccttgctgacgagatgggctcg gacaagaagacggccaacgcggccctcgatgcgatcgcctcgatcgtcgcccgtgaagtg gccgccggcggtgccgtgacgctgccgggcctcggcaaggtcgtctgccgcgagcgcccc gagcgtcaggtgcgcaatccggccaccggcgagcaggtgaccaaggccgccgacaagcag gtgaaattcaccatcgccaaggcgctgaaggacagcgtgaacgcctga

DBGET integrated database retrieval system