Cereibacter sphaeroides 2.4.1: RSP_2463 Help Entry RSP_2463          CDS       T00284                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rsp  Cereibacter sphaeroides 2.4.1 Pathway rsp01100   Metabolic pathways rsp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSP_2463 (acpP)    00074 Mycolic acid biosynthesis     RSP_2463 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSP_2463 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ABA78622 UniProt:  Q3J3L2 LinkDB All DBs Position 1:1103134..1103367 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEEKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgctgatcgcgtgaagaagatcgtcgtcgagcatctgggcgtcgaagag gagaaggtgaccgagaatgcctcgttcatcgacgacctcggcgcggacagcctcgacacg gtcgagctcgtgatggccttcgaggaagagttcggcatcgagatcccggacgatgcggcc gaaaccatccagaccttcggcgatgcggtgaagttcatctcggaagccgcctga

DBGET integrated database retrieval system