Cereibacter sphaeroides 2.4.1: RSP_7578 Help Entry RSP_7578          CDS       T00284                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rsp  Cereibacter sphaeroides 2.4.1 Brite KEGG Orthology (KO) [BR:rsp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rsp03036]     RSP_7578    03400 DNA repair and recombination proteins [BR:rsp03400]     RSP_7578 Chromosome and associated proteins [BR:rsp03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RSP_7578 DNA repair and recombination proteins [BR:rsp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RSP_7578 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  AGY32448 UniProt:  U5NMX2 LinkDB All DBs Position 1:3019852..3020130 Genome browser AA seq 92 aa AA seqDB search MKKTIERLNWDELLDLYGRISKALDACETRQAAAKARSMAAAISKGAGSGTKRVSYFNPA NRAVSWNGRGRCPNWFKVAMAQGRTPEELASL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagactattgagcggttgaactgggacgaactgctggacctctatggacggatc tccaaggcactcgacgcctgcgagacccggcaagccgccgcgaaggcgcgatccatggca gcagcgatctccaaaggggcaggaagcgggacgaagcgcgtgagctacttcaacccggca aatcgcgccgtgtcgtggaatggccgcgggcggtgtccgaactggttcaaggtggccatg gctcaggggcgcacgcccgaagaactggcctccctctga

DBGET integrated database retrieval system