Cereibacter sphaeroides ATCC 17025: Rsph17025_1622 Help Entry Rsph17025_1622    CDS       T00512                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism rsq  Cereibacter sphaeroides ATCC 17025 Pathway rsq02020   Two-component system rsq02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rsq00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Rsph17025_1622  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Rsph17025_1622  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rsq02035]     Rsph17025_1622 Bacterial motility proteins [BR:rsq02035]  Flagellar system   Flagellar assembly proteins    Others     Rsph17025_1622 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ABP70515 UniProt:  A4WT01 LinkDB All DBs Position 1667114..1667413 Genome browser AA seq 99 aa AA seqDB search MVESVVPTSGPSRLERLKDTQTRVDRSLAGAVAGSAQAKGETVELSAAALATPEELRSGP PVDLQMVQKIKDAIAEGKYPIDLDRITDALFADYLDLKL NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggtcgaatccgtcgtccccacatccggcccgagccgtctcgaacgcctgaaggacacc cagacccgggtggaccgatcccttgcgggcgccgttgcgggctccgcacaggcaaaaggt gaaacggtcgaactgagtgccgccgctctggccacgccggaagagctgcgctcggggccg cccgtggatctgcaaatggtgcagaagatcaaggacgcgatagccgaagggaaatatccc atcgacctcgaccgcatcaccgatgcgctcttcgcggactacctggatctgaagctctga

DBGET integrated database retrieval system