Cereibacter sphaeroides ATCC 17025: Rsph17025_2597 Help Entry Rsph17025_2597    CDS       T00512                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism rsq  Cereibacter sphaeroides ATCC 17025 Pathway rsq02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:rsq00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Rsph17025_2597  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:rsq02035]     Rsph17025_2597 Bacterial motility proteins [BR:rsq02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     Rsph17025_2597 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding IATP Motif Other DBs NCBI-ProteinID:  ABP71485 UniProt:  A4WVS1 LinkDB All DBs Position 2638484..2638762 Genome browser AA seq 92 aa AA seqDB search MSIAIPPAVGEAPHPRQILRQKAEELESAFLSEMLGHTGLGALSASFGGGCGEEQFGSFL RREQATEMVRAGGIGLAEHFHRSLTRGMDDAL NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgtcgatcgcgatccctcccgctgtcggagaggccccgcatccgcggcagatccttcgc cagaaggccgaggaactggaatccgcattcctgtcagagatgctcgggcacaccgggctc ggcgctttgtccgcctccttcggaggaggatgcggcgaagagcagttcggctcctttctg cgcagggagcaggccacggaaatggtgcgcgccggcgggatcgggctggcggagcatttc caccgatcgctgacgagagggatggacgatgcgctctga

DBGET integrated database retrieval system