Ruania suaedae: LQF12_05300 Help Entry LQF12_05300       CDS       T08275                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism rsua  Ruania suaedae Brite KEGG Orthology (KO) [BR:rsua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:rsua03032]     LQF12_05300    03036 Chromosome and associated proteins [BR:rsua03036]     LQF12_05300    03400 DNA repair and recombination proteins [BR:rsua03400]     LQF12_05300 DNA replication proteins [BR:rsua03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LQF12_05300 Chromosome and associated proteins [BR:rsua03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LQF12_05300 DNA repair and recombination proteins [BR:rsua03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LQF12_05300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 DUF5321 Motif Other DBs NCBI-ProteinID:  UFU04014 LinkDB All DBs Position 1172213..1172494 Genome browser AA seq 93 aa AA seqDB search MSVNRTELVAAIAEKAGLTKTDADAALGALQEVLVESLGKGEAVKVTGLLSVERVERAAR TGRNPRTGEEIQIPAGYGVKVSAGSALKKAVTK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt gtgtccgtcaaccgcactgagctcgttgccgccatcgccgagaaggctggactgaccaag accgacgccgacgccgccctgggcgcgctgcaggaggtcctcgtggagtccctcggcaag ggcgaggccgtcaaggtcaccggcctgctctccgtggagcgcgtcgagcgcgccgctcgc accggacgcaacccgcgcacgggcgaggagatccagatcccggccggctacggcgtcaag gtctccgccggttcggccctgaagaaggccgtcaccaagtga

DBGET integrated database retrieval system