Rhizobium sullae: N2599_15990 Help Entry N2599_15990       CDS       T08545                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism rsul  Rhizobium sullae Brite KEGG Orthology (KO) [BR:rsul00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rsul03110]     N2599_15990 (grxC) Chaperones and folding catalysts [BR:rsul03110]  Protein folding catalysts   Protein disulfide isomerase    N2599_15990 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like Motif Other DBs NCBI-ProteinID:  UWU13624 UniProt:  A0A2N0D964 LinkDB All DBs Position complement(3189343..3189615) Genome browser AA seq 90 aa AA seqDB search MAPVTIYTRQFCGYCTRAKSLLEEKGIDYVEHDATFSPDLRQEMLGKSNGRTTFPQIFVG AQHVGGCDDLYALERAGRLDPMLVAQRGDR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atggcacctgtcaccatctatacgcggcagttctgcggctattgcacccgcgccaagtcc ctcctcgaagagaaggggatcgattatgtcgaacacgacgcgaccttttcgccagacctc cgccaagagatgcttggcaagtcaaacggcaggacgaccttcccgcagatcttcgttggc gcgcagcatgtcggcggatgcgatgatctttatgcactggaacgggccggcaggctcgat cccatgctggtagcccaaaggggggaccgatga

DBGET integrated database retrieval system