Rickettsia slovaca 13-B: Rsl_1357 Help Entry Rsl_1357          CDS       T01671                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rsv  Rickettsia slovaca 13-B Pathway rsv01100   Metabolic pathways rsv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rsl_1357 (acpP)    00074 Mycolic acid biosynthesis     Rsl_1357 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rsl_1357 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEV92664 LinkDB All DBs Position 1093274..1093519 Genome browser AA seq 81 aa AA seqDB search MSTTDKIEQKVIEMVAEKLNKDKSIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD DEATKIKTVSDVIKYIKERQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtacaacggataagatcgaacagaaagttattgaaatggttgctgaaaagctaaat aaagataaatcgataataactacggattcaagatttatagaagatttgaaagctgatagc cttgataccgtagagttaatgatggcaatagaagttgaatacggtattgatatccctgat gatgaagccactaaaattaaaaccgtatccgatgttataaaatatatcaaagaacgccaa tcttaa

DBGET integrated database retrieval system