Rickettsia slovaca D-CWPP: MC3_06595 Help Entry MC3_06595         CDS       T01801                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rsw  Rickettsia slovaca D-CWPP Pathway rsw01100   Metabolic pathways rsw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MC3_06595 (acpP)    00074 Mycolic acid biosynthesis     MC3_06595 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MC3_06595 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 DUF1493 PP-binding_2 Motif Other DBs NCBI-ProteinID:  AFD20178 UniProt:  H8LQA1 LinkDB All DBs Position 1094114..1094359 Genome browser AA seq 81 aa AA seqDB search MSTTDKIEQKVIEMVAEKLNKDKSIITTDSRFIEDLKADSLDTVELMMAIEVEYGIDIPD DEATKIKTVSDVIKYIKERQS NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtacaacggataagatcgaacagaaagttattgaaatggttgctgaaaagctaaat aaagataaatcgataataactacggattcaagatttatagaagatttgaaagctgatagc cttgataccgtagagttaatgatggcaatagaagttgaatacggtattgatatccctgat gatgaagccactaaaattaaaaccgtatccgatgttataaaatatatcaaagaacgccaa tcttaa

DBGET integrated database retrieval system