Ralstonia solanacearum UY031: RSUY_14720 Help Entry RSUY_14720        CDS       T06155                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism rsy  Ralstonia solanacearum UY031 Pathway rsy00998   Biosynthesis of various antibiotics rsy01100   Metabolic pathways rsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSUY_14720    00074 Mycolic acid biosynthesis     RSUY_14720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSUY_14720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  ALF87830 UniProt:  A0A093U6Q9 LinkDB All DBs Position 1578866..1579105 Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacaacgcgtcaagaagatcgtcgccgagcaactgggcgtggccgag gctgacatcaagaacgaatcgtcgttcgtcaacgatctcggcgcggactcgctcgacacg gttgagctggtgatggcgttggaagatgagttcggtatggaaatcccggacgaagaagct gagaagatcaccacggtgcaacaagccatcgactacgctcgcgccaacgttaaggcgtaa

DBGET integrated database retrieval system