Ralstonia solanacearum UY031: RSUY_27590 Help Entry RSUY_27590        CDS       T06155                                  Name (GenBank) DNA-binding protein Fis   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism rsy  Ralstonia solanacearum UY031 Brite KEGG Orthology (KO) [BR:rsy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:rsy03000]     RSUY_27590    03036 Chromosome and associated proteins [BR:rsy03036]     RSUY_27590    03400 DNA repair and recombination proteins [BR:rsy03400]     RSUY_27590 Transcription factors [BR:rsy03000]  Prokaryotic type   Helix-turn-helix    Other families     RSUY_27590 Chromosome and associated proteins [BR:rsy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RSUY_27590 DNA repair and recombination proteins [BR:rsy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       RSUY_27590 SSDB OrthologParalogGFIT Motif Pfam:  HTH_8 HTH_30 HTH_17 SHLD1_C Xre-like-HTH NUMOD1 Motif Other DBs NCBI-ProteinID:  ALF89079 LinkDB All DBs Position 2943485..2943718 Genome browser AA seq 77 aa AA seqDB search MSRNPIERCIRDSLDTYYRDLDGENPSNVYDMVLQAIERPLLETVMEWASNNQSLAAEYL GINRNTLRKKLQQHGLL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagccgcaacccgatcgaacgctgcatccgggacagcctggatacgtactatcgcgac ctggacggcgaaaatccgtccaacgtctacgacatggtgctgcaggccatcgaacggccg ctgctggagaccgtgatggaatgggcctccaacaaccagtcgctggcggccgagtatctc ggcatcaaccgcaacacgctgcgcaagaaactgcagcagcacggactgctctag

DBGET integrated database retrieval system