Ralstonia solanacearum UY031: RSUY_28360 Help Entry RSUY_28360        CDS       T06155                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rsy  Ralstonia solanacearum UY031 Pathway rsy00998   Biosynthesis of various antibiotics rsy01100   Metabolic pathways rsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rsy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RSUY_28360    00074 Mycolic acid biosynthesis     RSUY_28360   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RSUY_28360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALF89153 LinkDB All DBs Position complement(3020253..3020513) Genome browser AA seq 86 aa AA seqDB search MNALEKELAELMIGELNLEDIQLDSVSADTPLYGEGFALDSIDILEIALLVSKKYGFELR SGNPDNQKIFASLGSLAAYIAAHRVR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaacgcactggaaaaagaactcgccgaactgatgatcggcgaattgaacctcgaagat attcagctcgacagcgtgtccgccgatacgcccctctatggggaaggcttcgcgctcgat tccatcgatatcctggaaatcgcgctgctggtctcgaaaaaatacggcttcgaactgcgt tcgggcaatccggataatcagaagattttcgcctcgctcggatcgctggccgcttacatc gcggcgcaccgcgtgcgctag

DBGET integrated database retrieval system