Ralstonia solanacearum UY031: RSUY_29190 Help Entry RSUY_29190        CDS       T06155                                  Symbol grxC Name (GenBank) Glutaredoxin-3   KO K03676   glutaredoxin 3 Organism rsy  Ralstonia solanacearum UY031 Brite KEGG Orthology (KO) [BR:rsy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rsy03110]     RSUY_29190 (grxC) Chaperones and folding catalysts [BR:rsy03110]  Protein folding catalysts   Protein disulfide isomerase    RSUY_29190 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_3 Thioredoxin_2 GST_N_2 Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  ALF89235 UniProt:  A0AAE3UYQ1 LinkDB All DBs Position complement(3100698..3100955) Genome browser AA seq 85 aa AA seqDB search MAHVVMYSTTVCPYCVAAEKLLKQRGVAHIEKILIDREPGRREEMMVRTNRRTVPQIYID DRHIGGFDDLSALDREGGLEPLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcccatgtcgtcatgtacagcacgaccgtctgcccctattgcgtggcagcggagaag ctcctgaagcagcgcggtgtcgcgcatatcgaaaagatcctgatcgaccgcgagcccggc cggcgcgaagagatgatggtgcgcaccaaccgccgtaccgtgccgcagatctacatcgac gatcgccatatcggcggctttgacgatctctccgcgctcgatcgggaaggcgggctggaa ccgctgctggcggcctga

DBGET integrated database retrieval system