Ralstonia solanacearum UY031: RSUY_46530 Help Entry RSUY_46530        CDS       T06155                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rsy  Ralstonia solanacearum UY031 Brite KEGG Orthology (KO) [BR:rsy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rsy03036]     RSUY_46530    03400 DNA repair and recombination proteins [BR:rsy03400]     RSUY_46530 Chromosome and associated proteins [BR:rsy03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     RSUY_46530 DNA repair and recombination proteins [BR:rsy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       RSUY_46530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Motif Other DBs NCBI-ProteinID:  ALF90955 LinkDB All DBs Position unnamed:1882464..1882754 Genome browser AA seq 96 aa AA seqDB search MATYKDLLAQKTKLEEQLEAARQKELATVTEQVRQVVLEYGLTAEDIGLAPKRGKRASAK TPVAPKYRDPKTGATWSGRGRAPAWLGKNRDKFLIA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaacttacaaagacctgcttgctcaaaagaccaagctcgaagagcaactcgaagcc gctcgccagaaagagctggcaaccgtcaccgagcaggtgcggcaagtcgtgctggaatac ggtctgaccgccgaggacatcggtctggcaccgaagcgcggcaagcgcgccagcgccaag acgcctgttgctcccaaataccgcgaccccaagaccggcgctacgtggtccggccgtggt cgtgcacccgcatggcttggcaagaaccgcgacaagttcctgatcgcctga

DBGET integrated database retrieval system