Raphanus sativus (radish): 108809307 Help Entry 108809307         CDS       T06014                                  Name (RefSeq) ras-related protein RABG2-like   KO K07897   Ras-related protein Rab-7A Organism rsz  Raphanus sativus (radish) Pathway rsz04144   Endocytosis rsz04145   Phagosome rsz04148   Efferocytosis Brite KEGG Orthology (KO) [BR:rsz00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108809307    04145 Phagosome     108809307    04148 Efferocytosis     108809307  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rsz04131]     108809307   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rsz04147]     108809307    04031 GTP-binding proteins [BR:rsz04031]     108809307 Membrane trafficking [BR:rsz04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108809307 Exosome [BR:rsz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108809307   Exosomal proteins of other body fluids (saliva and urine)    108809307   Exosomal proteins of colorectal cancer cells    108809307   Exosomal proteins of bladder cancer cells    108809307 GTP-binding proteins [BR:rsz04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108809307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Septin RsgA_GTPase nSTAND3 AAA_16 ATPase_2 PriS_C AAA_7 MMR_HSR1 AAA_22 AAA_24 NACHT nSTAND1 DAP3 PduV-EutP Sigma54_activat cobW AAA_5 Motif Other DBs NCBI-GeneID:  108809307 NCBI-ProteinID:  XP_056844325 UniProt:  A0A9W3BY80 LinkDB All DBs Position 6:43830469..43832045 Genome browser AA seq 174 aa AA seqDB search MESLKNRTLLKVIVLGDSGVGKTSLMNQYVYKKFNRQYKATIGADFVTKELHIEDKSVTL QRDEPLSIEVLIVVFLSTMSTISNLLKLSILGTLSSLNRWRKQPSYKRAIEWCGSKENIP YYETSAKEDVNVDEAFLGVAHKTLSSDLKQNIYIPVISEYFADIHEEQSRGCSC NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atggagtctttgaagaacagaacattgcttaaggtcattgtcctcggagatagcggggta ggcaaaacttcactgatgaaccaatacgtttacaagaagtttaaccgacaatataaggcc acgatcggagcagattttgtaaccaaggagcttcatattgaagataaatctgttacttta caaagagatgagccgctttctatcgaggtgctgattgttgtgttcttgtctacgatgtca acgatctcaaatcttttgaaactctcaatacttggcactctgagttccttaaacagatgg cggaaacagccgagttataagagagccattgaatggtgtggttcaaaggaaaacataccg tactatgaaacctctgcaaaggaagatgttaatgtggatgaagcctttttgggtgttgca cacaaaactctttctagtgaccttaaacaaaacatatatatcccagttatttctgaatat tttgcagacattcatgaggagcagtcaagaggttgttcttgctga

DBGET integrated database retrieval system