Raphanus sativus (radish): 108816544 Help Entry 108816544         CDS       T06014                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism rsz  Raphanus sativus (radish) Pathway rsz03083   Polycomb repressive complex rsz04120   Ubiquitin mediated proteolysis rsz04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:rsz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     108816544    04120 Ubiquitin mediated proteolysis     108816544   09126 Chromosome    03083 Polycomb repressive complex     108816544  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rsz04131]     108816544    04121 Ubiquitin system [BR:rsz04121]     108816544    03036 Chromosome and associated proteins [BR:rsz03036]     108816544 Membrane trafficking [BR:rsz04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     108816544 Ubiquitin system [BR:rsz04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      108816544    Cul7 complex      108816544 Chromosome and associated proteins [BR:rsz03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      108816544   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      108816544 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  108816544 NCBI-ProteinID:  XP_018444617 UniProt:  A0A6J0K9E7 LinkDB All DBs Position 7:16229101..16229824 Genome browser AA seq 155 aa AA seqDB search MIMLKSSDGESFVVEEAAARQSKIISFLVEEFPDQELPFTNLTSEILGKVMEYCKKHVVE DDVCGDSSSSSSSSDDLKKWDAKFVGEIDQPMLMDLIMAANYLHIPSLLDVTCQKVADMI AACNDEKEIRATFNIENDFTEEEVEAIRMENQYRN NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgatcatgttgaaaagctccgacggtgaatcgtttgtggtggaggaagcggccgctcgt cagtcgaagatcatatcgtttctcgttgaagagttccccgatcaagaattaccgtttacg aacctgacaagcgagatcctcggtaaagtgatggagtactgcaagaagcacgtggtggaa gacgacgtctgtggtgattcttcttcttcctcctcctcctccgatgatctcaagaagtgg gacgcgaagttcgtcggggaaatcgatcagccaatgctcatggatctcatcatggctgcg aactacctacacatcccaagccttctcgatgtgacttgccagaaagttgctgatatgatc gctgcatgcaacgacgagaaagagattcgcgcaacgttcaacatcgagaacgatttcacg gaagaggaagtggaagcgattcgcatggagaatcaataccgtaactag

DBGET integrated database retrieval system