Raphanus sativus (radish): 108818094 Help Entry 108818094         CDS       T06014                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism rsz  Raphanus sativus (radish) Pathway rsz03018   RNA degradation rsz03040   Spliceosome Brite KEGG Orthology (KO) [BR:rsz00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     108818094   09123 Folding, sorting and degradation    03018 RNA degradation     108818094  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:rsz03019]     108818094    03041 Spliceosome [BR:rsz03041]     108818094 Messenger RNA biogenesis [BR:rsz03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      108818094   mRNA degradation factors    5'-3' decay     Lsm complex      108818094 Spliceosome [BR:rsz03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     108818094 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  108818094 NCBI-ProteinID:  XP_018446460 UniProt:  A0A6J0KG09 LinkDB All DBs Position 7:9907276..9909032 Genome browser AA seq 98 aa AA seqDB search MATTTGLESLVDQIISVITNDGRNIVGLLKGFDQATNIILDESHERVFSTKEGVQQHVLG LYIIRGDNIGVIGELDEELDASLDFSKLRAHPLKPVVH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcgacaactactggacttgagtctcttgtcgatcagatcatttcggtaatcaccaat gatggacgcaacattgtgggacttctcaaaggttttgaccaggctactaatataatcctg gatgaatctcatgaacgcgtcttctccaccaaggaaggagtacaacaacatgtgttgggt ttgtacattatcagaggcgacaacataggtgttattggggagctggacgaggagcttgat gctagtctggatttttccaaactgagggctcatcctttgaaacccgtcgtgcattga

DBGET integrated database retrieval system