Raphanus sativus (radish): 108818127 Help Entry 108818127         CDS       T06014                                  Name (RefSeq) calmodulin-2   KO K02183   calmodulin Organism rsz  Raphanus sativus (radish) Pathway rsz04016   MAPK signaling pathway - plant rsz04070   Phosphatidylinositol signaling system rsz04075   Plant hormone signal transduction rsz04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:rsz00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     108818127    04070 Phosphatidylinositol signaling system     108818127    04075 Plant hormone signal transduction     108818127  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     108818127  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:rsz01009]     108818127   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rsz04131]     108818127    03036 Chromosome and associated proteins [BR:rsz03036]     108818127   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rsz04147]     108818127 Protein phosphatases and associated proteins [BR:rsz01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      108818127 Membrane trafficking [BR:rsz04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     108818127 Chromosome and associated proteins [BR:rsz03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      108818127 Exosome [BR:rsz04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108818127 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 SAPC2_N DUF5580_M Dockerin_1 RNA_pol_Rpb4 EF-hand_EFHB_C EFhand_Ca_insen Caleosin MotA_activ FCaBP_EF-hand SPEF2_C EF-hand_STIM1 PA_Ig-like SurA_N_3 DUF6279 MecA_N Motif Other DBs NCBI-GeneID:  108818127 NCBI-ProteinID:  XP_018446504 UniProt:  A0A6J0NVD5 LinkDB All DBs Position 7:17463018..17464372 Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIKEADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcagctcaccgacgatcagatctccgagttcaaggaagccttcagcttattc gacaaggatggtgacggttgcattaccaccaaggagctgggaactgtgatgcgttctcta ggacagaacccaaccgaagcagagcttcaagacatgattaatgaagttgacgctgatggt aacggcaccattgatttccccgagttcttgaacctcatggctcgcaagatgaaggacacc gactccgaggaagagctcaaggaggcgttccgggtgtttgacaaggaccagaacggtttc atctcagctgctgagcttcgccatgtgatgacaaacttaggtgagaagctcactgacgaa gaggttgatgagatgatcaaggaagctgatgttgatggtgatggccagattaactatgag gagtttgtcaaggtcatgatggctaagtga

DBGET integrated database retrieval system