Raphanus sativus (radish): 108856886 Help Entry 108856886         CDS       T06014                                  Name (RefSeq) ubiquitin-like protein ATG12B   KO K08336   ubiquitin-like protein ATG12 Organism rsz  Raphanus sativus (radish) Pathway rsz04136   Autophagy - other Brite KEGG Orthology (KO) [BR:rsz00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     108856886  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rsz04131]     108856886    04121 Ubiquitin system [BR:rsz04121]     108856886    03029 Mitochondrial biogenesis [BR:rsz03029]     108856886 Membrane trafficking [BR:rsz04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     108856886 Ubiquitin system [BR:rsz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    108856886 Mitochondrial biogenesis [BR:rsz03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     108856886 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 DUF4264 Motif Other DBs NCBI-GeneID:  108856886 NCBI-ProteinID:  XP_018486288 UniProt:  A0A6J0NRG7 LinkDB All DBs Position 5:complement(5303959..5305314) Genome browser AA seq 94 aa AA seqDB search MATESPSSVRKIVVHLRATGGAPILKRDKFKISGTDKFAKVIDFLGRQLHSDSLFVYVNS AFSPNPDESVIDLYNNFGIDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcgacggagtcgccgagttccgttcggaaaatcgttgttcatctaagagctactggc ggtgctccaatactgaaacgagataagttcaagatttcagggacggataagtttgctaaa gtgattgactttctaggaaggcagcttcactctgactcattgtttgtgtatgtaaacagt gctttctcgccaaaccctgatgaatcagtaattgatctatacaataactttgggatagat gggaaactggtggtgaactatgcttgttccatggcatggggataa

DBGET integrated database retrieval system