Raphanus sativus (radish): 108858895 Help Entry 108858895         CDS       T06014                                  Name (RefSeq) GTP-binding protein YPTC5-like   KO K07897   Ras-related protein Rab-7A Organism rsz  Raphanus sativus (radish) Pathway rsz04144   Endocytosis rsz04145   Phagosome rsz04148   Efferocytosis Brite KEGG Orthology (KO) [BR:rsz00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108858895    04145 Phagosome     108858895    04148 Efferocytosis     108858895  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rsz04131]     108858895   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rsz04147]     108858895    04031 GTP-binding proteins [BR:rsz04031]     108858895 Membrane trafficking [BR:rsz04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108858895 Exosome [BR:rsz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108858895   Exosomal proteins of other body fluids (saliva and urine)    108858895   Exosomal proteins of colorectal cancer cells    108858895   Exosomal proteins of bladder cancer cells    108858895 GTP-binding proteins [BR:rsz04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108858895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc AAA_16 MMR_HSR1 Septin RsgA_GTPase DUF815 Dynamin_N AAA_22 RNA_helicase AAA_14 AAA_7 ATPase_2 AAA_24 AAA_29 TniB Motif Other DBs NCBI-GeneID:  108858895 NCBI-ProteinID:  XP_056853938 UniProt:  A0A9W3CSK1 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MVLPILVVGDRGVGKSSLINRFVNRELTAEIDGALVRWMEIDDKIWKSKICEDSVSLYRR DRICCCVLVFDVNDITSFDSLNKHIDQYVYQMLRVNPNSDHFPLNITNKKKHLLFFSFFE VAKNHNTHGNDLRQNLMIFLSEFANVVSIDPHNANW NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggttttaccgattttagttgttggtgacagaggggttggtaaatcatcattgattaac aggtttgttaatcgtgagcttacggctgagattgatggcgctctggtaagatggatggaa attgatgataagatctggaagtcgaagatttgcgaggatagcgtgtccctttatcgacgt gatcgaatctgttgctgtgttcttgtctttgatgtcaacgacataacatcgtttgacagt ctcaacaaacatattgaccagtatgtttatcagatgctaagagtcaatccgaactcagat cacttccccctcaacataaccaacaagaagaaacatttattatttttctctttttttgaa gtagcaaagaaccataatactcatggaaatgacttgagacaaaacctgatgatttttctt tcagagtttgctaatgttgtcagcattgatccacataatgctaattggtaa

DBGET integrated database retrieval system