Ramlibacter tataouinensis: Rta_28510 Help Entry Rta_28510         CDS       T01544                                  Symbol acpP Name (GenBank) Candidate Acyl-carrier-protein   KO K02078   acyl carrier protein Organism rta  Ramlibacter tataouinensis Pathway rta01100   Metabolic pathways rta01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rta00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Rta_28510 (acpP)    00074 Mycolic acid biosynthesis     Rta_28510 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Rta_28510 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  AEG93954 UniProt:  F5Y5S0 LinkDB All DBs Position complement(3035833..3036072) Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANAHQKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaagaagatcatcgccgagcaactcggcgtcgaagag tcccaggtgaccaacgagaaggccttcgtggccgatctgggcgccgactcgctggacacg gtcgagctggtgatggcgctggaagacgaattcggcatcgagatcccggacgaggacgcc gagaagatcaccaccgtgcagaacgcgatcgactacgccaacgcgcaccagaaggcttaa

DBGET integrated database retrieval system