Ramlibacter tataouinensis: Rta_30750 Help Entry Rta_30750         CDS       T01544                                  Symbol grxC Name (GenBank) Candidate glutaredoxin   KO K03676   glutaredoxin 3 Organism rta  Ramlibacter tataouinensis Brite KEGG Orthology (KO) [BR:rta00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rta03110]     Rta_30750 (grxC) Chaperones and folding catalysts [BR:rta03110]  Protein folding catalysts   Protein disulfide isomerase    Rta_30750 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 Thioredoxin_3 DUF3203 DSBA Motif Other DBs NCBI-ProteinID:  AEG94185 UniProt:  F5XWP1 LinkDB All DBs Position complement(3282744..3283001) Genome browser AA seq 85 aa AA seqDB search MQTVKMYTTAVCPYCIRAKQILKSKGVEAIEEIRIDTRPEERMKMMEITGRRTVPQIFIG DTHVGGCDDLIALDGRGGLVPLLQG NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccgtcaagatgtacaccacggccgtctgcccctactgcatccgcgccaagcag atcctcaagtccaagggcgtcgaggccatcgaggagatccgcatcgacacccggcccgag gagcggatgaagatgatggagatcaccggccggcgcaccgttccgcagatcttcataggc gacacccacgtcggcggctgcgacgacctgatcgcactggacggccgcggcggcctggtg ccgctgttgcagggataa

DBGET integrated database retrieval system