Ramlibacter terrae: HK414_05625 Help Entry HK414_05625       CDS       T08049                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rtea  Ramlibacter terrae Brite KEGG Orthology (KO) [BR:rtea00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rtea03036]     HK414_05625    03400 DNA repair and recombination proteins [BR:rtea03400]     HK414_05625 Chromosome and associated proteins [BR:rtea03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     HK414_05625 DNA repair and recombination proteins [BR:rtea03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       HK414_05625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GreA_GreB_N CysS_C Motif Other DBs NCBI-ProteinID:  QJW83707 UniProt:  A0ABX6P1X6 LinkDB All DBs Position 1058803..1059006 Genome browser AA seq 67 aa AA seqDB search MKEQAEKLLAEAEKMREKEIADTISDIKEKIRAYGLTAEDTGWRAAPPCAAFAPRALLRP PVPRPQW NT seq 204 nt NT seq  +upstreamnt  +downstreamnt ttgaaggagcaggccgaaaagctgctggcggaagctgaaaagatgcgtgaaaaggagatc gccgacacgatttccgatatcaaggaaaagatccgggcgtacggattgaccgcggaagac acgggctggcgcgcggcgcccccgtgcgcggcgttcgcgccaagagcgctcctgcggccg ccggtaccgcggccccaatggtga

DBGET integrated database retrieval system