Rana temporaria (common frog): 120909227 Help Entry 120909227         CDS       T07929                                  Name (RefSeq) histone H2A type 1   KO K11251   histone H2A Organism rtem  Rana temporaria (common frog) Pathway rtem03082   ATP-dependent chromatin remodeling rtem04217   Necroptosis Brite KEGG Orthology (KO) [BR:rtem00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120909227  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120909227  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rtem03036]     120909227   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120909227 Chromosome and associated proteins [BR:rtem03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120909227 Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120909227 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120909227 NCBI-ProteinID:  XP_040176884 LinkDB All DBs Position 8:complement(155176341..155176839) Genome browser AA seq 130 aa AA seqDB search MSGRGKQGGKVRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TESHKATKSK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgcggcaaacaaggaggcaaggttcgggctaaggccaagacacgctcatcc cgggctggtctgcagttcccagtcggtcgtgttcaccgtctgctcaggaagggtaactat gccgagcgggtcggcgccggagctccagtgtatctcgccgccgtcctcgagtatctgacg gctgagatcctcgagctggccggcaacgccgcccgcgacaacaagaagacccgcatcatc ccccgacacctccagctggctgtccgcaacgacgaggagctcaacaagctgctgggcggc gtcaccatcgcccagggaggagtgctgcccaacatccaggccgtgctgctgcccaagaag accgagagccacaaggccaccaaatccaagtaa

DBGET integrated database retrieval system