Rana temporaria (common frog): 120913910 Help Entry 120913910         CDS       T07929                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism rtem  Rana temporaria (common frog) Pathway rtem04081   Hormone signaling rtem04144   Endocytosis rtem04150   mTOR signaling pathway rtem04270   Vascular smooth muscle contraction rtem04310   Wnt signaling pathway rtem04350   TGF-beta signaling pathway rtem04510   Focal adhesion rtem04520   Adherens junction rtem04530   Tight junction rtem04621   NOD-like receptor signaling pathway rtem04625   C-type lectin receptor signaling pathway rtem04810   Regulation of actin cytoskeleton rtem05100   Bacterial invasion of epithelial cells rtem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtem00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     120913910    04350 TGF-beta signaling pathway     120913910    04150 mTOR signaling pathway     120913910   09133 Signaling molecules and interaction    04081 Hormone signaling     120913910  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120913910   09144 Cellular community - eukaryotes    04510 Focal adhesion     120913910    04520 Adherens junction     120913910    04530 Tight junction     120913910   09142 Cell motility    04810 Regulation of actin cytoskeleton     120913910  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120913910    04625 C-type lectin receptor signaling pathway     120913910   09153 Circulatory system    04270 Vascular smooth muscle contraction     120913910  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120913910    05100 Bacterial invasion of epithelial cells     120913910  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtem04131]     120913910   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120913910    04031 GTP-binding proteins [BR:rtem04031]     120913910 Membrane trafficking [BR:rtem04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     120913910 Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120913910   Exosomal proteins of other body fluids (saliva and urine)    120913910   Exosomal proteins of colorectal cancer cells    120913910   Exosomal proteins of bladder cancer cells    120913910 GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     120913910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  120913910 NCBI-ProteinID:  XP_040180186 LinkDB All DBs Position 9:complement(117758317..117772116) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYLECSAKTKDGVREVFEMATRAALQ AKRGRKKNTCNLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatacgtaaaaagcttgtgattgttggagatggagcttgcgggaagacttgt ctgctcatcgtgttcagcaaggatcagttccctgaagtctatgtgcccaccgtgtttgag aattacgtagcagatatcgaagttgattccaaacaggtggagctagcactgtgggatacc gccggtcaggaagactacgatcgccttcgacccctgtcctatcccgatactgatgtcatt cttatgtgcttctccatagacagccctgatagcttggagaatatcccagagaagtggact ccggaagtgaagcatttttgccccaatgtgcctataattctggtgggaaacaagaaggac ttaaggaacgatgaacacactcgtcgtgagctggctaaaatgaaacaggaaccagtgaag ccagaagaaggccgggacatggccaataggatcggagcatttggctacctggaatgctct gccaaaacaaaggacggtgtgcgggaagtgtttgagatggcaacaagagctgctctacag gccaaacgagggcgtaagaaaaacacgtgcaatctgctttaa

DBGET integrated database retrieval system