Rana temporaria (common frog): 120916876 Help Entry 120916876         CDS       T07929                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism rtem  Rana temporaria (common frog) Pathway rtem04621   NOD-like receptor signaling pathway rtem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtem00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120916876  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120916876  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:rtem03110]     120916876 Chaperones and folding catalysts [BR:rtem03110]  Protein folding catalysts   Protein disulfide isomerase    120916876 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin OST3_OST6 Thioredoxin_2 Thioredoxin_9 Thioredoxin_8 AhpC-TSA DIM1 Redoxin Thioredoxin_7 BrxC Motif Other DBs NCBI-GeneID:  120916876 NCBI-ProteinID:  XP_040183753 LinkDB All DBs Position 11:35647239..35647621 Genome browser AA seq 105 aa AA seqDB search MVKQIETVADFTAFLASAGDKLVVVVFTAVWCGPCRMIAPIFEELCKTHSDVFFCKVDVN DVADLSESCGIHAMPTFQFYKNKEKIEEFSGAEDAKLKATIARLK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcaaatagagaccgtggcagactttactgcattcttggcatctgcgggtgac aaactggttgtcgttgttttcactgcagtatggtgtggaccgtgccgaatgattgctccc atatttgaggaactttgcaaaacacattctgatgtattcttttgtaaagtagacgtgaat gacgtagcggatttatcagaatcgtgtggcatccacgccatgcctacttttcaattttac aaaaacaaagaaaagattgaagaattttctggtgcagaagacgccaagcttaaggcaacc attgctaggctgaaataa

DBGET integrated database retrieval system