Rana temporaria (common frog): 120917286 Help Entry 120917286         CDS       T07929                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism rtem  Rana temporaria (common frog) Pathway rtem04010   MAPK signaling pathway rtem04068   FoxO signaling pathway rtem04081   Hormone signaling rtem04114   Oocyte meiosis rtem04140   Autophagy - animal rtem04150   mTOR signaling pathway rtem04810   Regulation of actin cytoskeleton rtem04910   Insulin signaling pathway rtem04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:rtem00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120917286 (INS)    04068 FoxO signaling pathway     120917286 (INS)    04150 mTOR signaling pathway     120917286 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     120917286 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120917286 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     120917286 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120917286 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120917286 (INS)    04914 Progesterone-mediated oocyte maturation     120917286 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:rtem04052]     120917286 (INS) Cytokines and neuropeptides [BR:rtem04052]  Neuropeptides   Unclassified    120917286 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  120917286 NCBI-ProteinID:  XP_040184408 LinkDB All DBs Position 11:complement(44585374..44592674) Genome browser AA seq 140 aa AA seqDB search MCEQAHNGHSDICHLSCEHSPSSFFSRFTIHLLIMALWIQCLPLAVLLSLFTPNAQAFPN QFLCGSHLVEALYMVCGDRGFFYSPRSRRDLEQPLVNGLQGSELDEMQVQSQGFQKRKPG IVEQCCHNTCSLYDMESYCA NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtgcgagcaggctcataacggtcactctgacatctgtcatctttcctgtgaacatagt ccatcttccttcttctccaggtttaccatccacctcctcatcatggccctgtggattcag tgtctccctcttgcagtccttctcagcctatttactcccaacgctcaagcctttcccaat caattcctttgtgggtctcaccttgtggaagccctatatatggtgtgtggagatagaggt ttcttctactcccccagaagtagaagggatctggaacagcccttagtaaatggcctccag ggcagcgagctggacgaaatgcaggtccaatcacaggggttccagaagaggaagccaggc attgtggaacagtgctgtcacaacacatgctctttgtatgatatggagagttactgcgcc taa

DBGET integrated database retrieval system