Rana temporaria (common frog): 120917364 Help Entry 120917364         CDS       T07929                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism rtem  Rana temporaria (common frog) Pathway rtem04010   MAPK signaling pathway rtem04012   ErbB signaling pathway rtem04068   FoxO signaling pathway rtem04137   Mitophagy - animal rtem04140   Autophagy - animal rtem04144   Endocytosis rtem04150   mTOR signaling pathway rtem04210   Apoptosis rtem04218   Cellular senescence rtem04370   VEGF signaling pathway rtem04371   Apelin signaling pathway rtem04510   Focal adhesion rtem04540   Gap junction rtem04625   C-type lectin receptor signaling pathway rtem04810   Regulation of actin cytoskeleton rtem04910   Insulin signaling pathway rtem04912   GnRH signaling pathway rtem04916   Melanogenesis rtem05132   Salmonella infection Brite KEGG Orthology (KO) [BR:rtem00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120917364 (HRAS)    04012 ErbB signaling pathway     120917364 (HRAS)    04370 VEGF signaling pathway     120917364 (HRAS)    04371 Apelin signaling pathway     120917364 (HRAS)    04068 FoxO signaling pathway     120917364 (HRAS)    04150 mTOR signaling pathway     120917364 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120917364 (HRAS)    04140 Autophagy - animal     120917364 (HRAS)    04137 Mitophagy - animal     120917364 (HRAS)   09143 Cell growth and death    04210 Apoptosis     120917364 (HRAS)    04218 Cellular senescence     120917364 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120917364 (HRAS)    04540 Gap junction     120917364 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120917364 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120917364 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120917364 (HRAS)    04912 GnRH signaling pathway     120917364 (HRAS)    04916 Melanogenesis     120917364 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120917364 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtem04131]     120917364 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120917364 (HRAS)    04031 GTP-binding proteins [BR:rtem04031]     120917364 (HRAS) Membrane trafficking [BR:rtem04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120917364 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120917364 (HRAS) Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120917364 (HRAS)   Exosomal proteins of colorectal cancer cells    120917364 (HRAS) GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120917364 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 Arf GTP_EFTU Septin RsgA_GTPase nSTAND3 Ldh_1_N NB-ARC AAA_14 CbiA AAA_16 Motif Other DBs NCBI-GeneID:  120917364 NCBI-ProteinID:  XP_040184537 LinkDB All DBs Position 11:complement(58099780..58190966) Genome browser AA seq 107 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYRCVAQETSHLF NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctagtggtggtgggtgccggaggcgttggtaaaagtgccttgacc atacagcttatacagaaccattttgtggatgaatatgatccaaccatagaggattcctac agaaaacaggttgttatcgatggagagacctgccttctggatatcctggacacagctggt caggaggagtacagtgcaatgcgtgaccagtacatgaggacaggagagggcttcttatgt gtatttgctatcaacaatactaaatcttttgaggatatacatcagtacaggtgtgtagct caagagacctctcatttgttttaa

DBGET integrated database retrieval system