Rana temporaria (common frog): 120923787 Help Entry 120923787         CDS       T07929                                  Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism rtem  Rana temporaria (common frog) Pathway rtem04010   MAPK signaling pathway rtem04137   Mitophagy - animal rtem04140   Autophagy - animal rtem04218   Cellular senescence rtem04371   Apelin signaling pathway rtem04625   C-type lectin receptor signaling pathway rtem04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:rtem00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120923787    04371 Apelin signaling pathway     120923787  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120923787    04137 Mitophagy - animal     120923787   09143 Cell growth and death    04218 Cellular senescence     120923787   09142 Cell motility    04810 Regulation of actin cytoskeleton     120923787  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120923787  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120923787    04031 GTP-binding proteins [BR:rtem04031]     120923787 Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120923787   Exosomal proteins of bladder cancer cells    120923787 GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120923787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Motif Other DBs NCBI-GeneID:  120923787 NCBI-ProteinID:  XP_040190963 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MSGGRDGAVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFAVTDRGSFEEIYKFQRQILRVKDRDEFPM VLVGNKADLEHQRQVTQEEGHQLARQLKVPYLEASAKIRMNVDQAFHELVRVVRKFHEQE CPPSPEPTRKEKDKKGCHCVIF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgtccggagggagggacggcgccgtgcaggagaagtaccggctggtggtggtgggagga ggcggggtggggaagtccgccctcaccatacaattcatccagtcgtactttgtgacggat tatgacccgaccatcgaggattcctacaccaagcaatgcgtcatcgacgagcgcgccgca cgcctggacattctggacacggcgggacaggaggagttcggtgcgatgcgggagcagtac atgaggacgggggaggggttcctgttggtgttcgcggtgacggacagagggagcttcgag gagatctataaattccagcggcagatcctgcgggtgaaggaccgggacgagttcccgatg gtcctggtcgggaacaaagcggatctggagcaccagcggcaggtgacgcaggaggaagga caccagctggcgcggcagttgaaagttccgtatctggaagcctcggccaagatcaggatg aacgtggatcaggcgtttcacgaactcgtgcgcgttgtcaggaagttccatgaacaggag tgccccccgtccccggagccgacgcggaaggagaaggacaagaagggttgccattgcgtc attttctaa

DBGET integrated database retrieval system