Rana temporaria (common frog): 120928080 Help Entry 120928080         CDS       T07929                                  Symbol CSTA Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism rtem  Rana temporaria (common frog) Brite KEGG Orthology (KO) [BR:rtem00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:rtem01002]     120928080 (CSTA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:rtem04147]     120928080 (CSTA) Peptidases and inhibitors [BR:rtem01002]  Peptidase inhibitors   Family I25: cystatin family    120928080 (CSTA) Exosome [BR:rtem04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    120928080 (CSTA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Motif Other DBs NCBI-GeneID:  120928080 NCBI-ProteinID:  XP_040195106 LinkDB All DBs Position 2:complement(534584918..534597678) Genome browser AA seq 103 aa AA seqDB search MPMVGGLGGVKPATPEVQEICDQFKAEVQQKSGKNFGTFEAIEFKTQLVAGTNYFIKTHI GDNQYVHLRIYKKLPCYQEEMSLTAFQVGKTREDHIVHFEPSD NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgccgatggtcgggggtctagggggtgtgaaaccagccaccccggaggtgcaggagatc tgtgatcagttcaaagcggaggtgcagcagaaatccgggaagaatttcgggactttcgaa gccattgaattcaagactcagcttgttgccggaacaaattacttcattaagactcacata ggagataatcagtatgtacatctgcggatctacaagaagctcccgtgttaccaggaggag atgagcctcaccgccttccaggtgggcaagaccagagaggaccacatcgtccactttgaa cccagcgactga

DBGET integrated database retrieval system