Rana temporaria (common frog): 120932753 Help Entry 120932753         CDS       T07929                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism rtem  Rana temporaria (common frog) Pathway rtem04010   MAPK signaling pathway rtem04012   ErbB signaling pathway rtem04068   FoxO signaling pathway rtem04137   Mitophagy - animal rtem04140   Autophagy - animal rtem04150   mTOR signaling pathway rtem04210   Apoptosis rtem04218   Cellular senescence rtem04370   VEGF signaling pathway rtem04371   Apelin signaling pathway rtem04540   Gap junction rtem04625   C-type lectin receptor signaling pathway rtem04810   Regulation of actin cytoskeleton rtem04910   Insulin signaling pathway rtem04912   GnRH signaling pathway rtem04914   Progesterone-mediated oocyte maturation rtem04916   Melanogenesis Brite KEGG Orthology (KO) [BR:rtem00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120932753 (KRAS)    04012 ErbB signaling pathway     120932753 (KRAS)    04370 VEGF signaling pathway     120932753 (KRAS)    04371 Apelin signaling pathway     120932753 (KRAS)    04068 FoxO signaling pathway     120932753 (KRAS)    04150 mTOR signaling pathway     120932753 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120932753 (KRAS)    04137 Mitophagy - animal     120932753 (KRAS)   09143 Cell growth and death    04210 Apoptosis     120932753 (KRAS)    04218 Cellular senescence     120932753 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120932753 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120932753 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120932753 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120932753 (KRAS)    04912 GnRH signaling pathway     120932753 (KRAS)    04914 Progesterone-mediated oocyte maturation     120932753 (KRAS)    04916 Melanogenesis     120932753 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:rtem04131]     120932753 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:rtem04031]     120932753 (KRAS) Membrane trafficking [BR:rtem04131]  Endocytosis   Macropinocytosis    Ras GTPases     120932753 (KRAS) GTP-binding proteins [BR:rtem04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120932753 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  120932753 NCBI-ProteinID:  XP_040201348 LinkDB All DBs Position 3:365852297..365885341 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKLSKEEKTPGC VKIKKCRVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctagtagtggtcggagctggaggcgttgggaagagtgctttgaca atacaactaattcagaatcattttgtcgatgaatatgatcccaccatagaggactcttat agaaaacaagtggttattgatggggagacctgcctactggatatcctggacacagcgggt caagaggagtatagtgcaatgagagaccagtacatgcggacgggggagggtttcctctgc gtctttgcaattaataacactaaatcatttgaggacattcatcattatagagaacagata aaaagagtaaaagattcagaggacgtaccaatggttttagtcggcaacaaatgtgactta ccttccagaacggtagacaccaagcaagctcaggacttggcgcggagctatggaattcct tttattgagacatctgcaaaaaccagacagagagtggaggatgccttttatacattggtg agagagatccgccagtacagattgaaaaaactgagcaaagaggagaagacccccggctgt gtgaaaattaaaaagtgccgtgtcatgtga

DBGET integrated database retrieval system